PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016464597.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 219aa    MW: 24826.4 Da    PI: 9.4781
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016464597.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF67.21.6e-211663249
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    +ie k   qvtfskRr g++KKA+EL++LC++e+a+i+fs+  k++ +
  XP_016464597.1 16 KIEVKNHLQVTFSKRRSGLFKKASELCTLCGVEIAIIVFSPARKVFSF 63
                    58888899**********************************999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.703767IPR002100Transcription factor, MADS-box
SMARTSM004321.6E-30766IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.63E-27889IPR002100Transcription factor, MADS-box
CDDcd002654.52E-33881No hitNo description
PRINTSPR004041.3E-17929IPR002100Transcription factor, MADS-box
PfamPF003191.1E-231663IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-172944IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-174465IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MAKKPSIGRQ KIKIAKIEVK NHLQVTFSKR RSGLFKKASE LCTLCGVEIA IIVFSPARKV  60
FSFGHPNVES IIDRFLSRNH NPISNSSLHL VEAHRNASVR ELNLQLTQIL AELEIEKIRG  120
ESLDQMRKTS QSQYWWEAPI SQLGLHELEQ LKESMEVLKN NVTNQESKFI VEITANSSFY  180
FGVNGNGIFD NYDIKPAQIM VASNNLHNHN FGFDSAGLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A7e-15893186Myocyte-specific enhancer factor 2A
3kov_B7e-15893186Myocyte-specific enhancer factor 2A
3kov_I7e-15893186Myocyte-specific enhancer factor 2A
3kov_J7e-15893186Myocyte-specific enhancer factor 2A
3p57_A7e-15893186Myocyte-specific enhancer factor 2A
3p57_B7e-15893186Myocyte-specific enhancer factor 2A
3p57_C7e-15893186Myocyte-specific enhancer factor 2A
3p57_D7e-15893186Myocyte-specific enhancer factor 2A
3p57_I7e-15893186Myocyte-specific enhancer factor 2A
3p57_J7e-15893186Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2402041e-176AC240204.1 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-33m2 map 1, complete sequence.
GenBankHG9754401e-176HG975440.1 Solanum pennellii chromosome ch01, complete genome.
GenBankHG9755131e-176HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016464597.11e-161PREDICTED: agamous-like MADS-box protein AGL62
SwissprotQ9FKK26e-59AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLM1DUY31e-128M1DUY3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000948161e-128(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20424223
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.14e-60AGAMOUS-like 62